BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7665[269482] (476 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7666[269482] (108 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7667[269482] (37 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7668[269482] (119 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7669[269482] (210 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7670[269482] (235 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ENSP00000249783 pep:known chromosome:NCBI36:15:46410913:46422862... 47 1e-05 ENSP00000370376 pep:known-ccds chromosome:NCBI36:15:46410913:464... 47 1e-05 >ENSP00000249783 pep:known chromosome:NCBI36:15:46410913:46422862:1 gene:ENSG00000128951 transcript:ENST00000249783 Length = 250 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 10/129 (7%) Query: 4 LKIKRLHPDAVIPKFATEGAACFDLVAIDVDNAVAHPNDRQAAIVRTGLAVEIPPGYVMK 63 L+ RL A P + AA +DL + D + P ++ A+V+T + + +P G + Sbjct: 112 LRFARLSEHATAPTRGSARAAGYDLYSA-YDYTIP-PMEK--AVVKTDIQIALPSGCYGR 167 Query: 64 IYSRSGHGFRDAVRLSNCVGIIDRDYRGEIKVALRADGG-NYVVNNGDRVAQAMLELAPS 122 + RSG + + + G+ID DYRG + V L G + V GDR+AQ + E Sbjct: 168 VAPRSGLAAKHFIDVG--AGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICE---R 222 Query: 123 VQFAEVEDL 131 + + E+E++ Sbjct: 223 IFYPEIEEV 231 >ENSP00000370376 pep:known-ccds chromosome:NCBI36:15:46410913:46422862:1 gene:ENSG00000128951 transcript:ENST00000331200 CCDS32231.1 Length = 252 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 37/129 (28%), Positives = 63/129 (48%), Gaps = 10/129 (7%) Query: 4 LKIKRLHPDAVIPKFATEGAACFDLVAIDVDNAVAHPNDRQAAIVRTGLAVEIPPGYVMK 63 L+ RL A P + AA +DL + D + + A+V+T + + +P G + Sbjct: 114 LRFARLSEHATAPTRGSARAAGYDLYSA-YDYTIP---PMEKAVVKTDIQIALPSGCYGR 169 Query: 64 IYSRSGHGFRDAVRLSNCVGIIDRDYRGEIKVALRADGG-NYVVNNGDRVAQAMLELAPS 122 + RSG + + + G+ID DYRG + V L G + V GDR+AQ + E Sbjct: 170 VAPRSGLAAKHFIDVG--AGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICE---R 224 Query: 123 VQFAEVEDL 131 + + E+E++ Sbjct: 225 IFYPEIEEV 233 BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7671[269482] (100 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7672[269482] (467 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7673[269482] (218 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7674[269482] (271 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7675[269482] (84 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7676[269482] (364 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7677[269482] (175 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7678[269482] (206 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7679[269482] (121 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7680[269482] (107 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7681[269482] (149 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7682[269482] (94 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7683[269482] (75 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7684[269482] (104 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7685[269482] (104 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7686[269482] (123 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7687[269482] (81 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7688[269482] (60 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7689[269482] (238 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7690[269482] (102 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7691[269482] (208 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7692[269482] (98 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7693[269482] (165 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7694[269482] (90 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7695[269482] (208 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7696[269482] (195 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7697[269482] (101 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7698[269482] (210 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7699[269482] (117 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7700[269482] (509 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7701[269482] (296 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7702[269482] (249 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7703[269482] (153 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7704[269482] (163 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7705[269482] (85 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7706[269482] (91 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7707[269482] (140 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7708[269482] (114 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7709[269482] (342 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7710[269482] (190 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7711[269482] (128 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7712[269482] (180 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7713[269482] (66 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7714[269482] (235 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7715[269482] (176 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7716[269482] (443 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7717[269482] (235 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7718[269482] (237 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7719[269482] (369 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7720[269482] (297 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7721[269482] (133 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7722[269482] (143 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7723[269482] (225 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7724[269482] (165 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7725[269482] (114 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7726[269482] (402 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7727[269482] (216 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7728[269482] (109 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7729[269482] (213 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7730[269482] (128 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7731[269482] (137 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7732[269482] (252 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7733[269482] (294 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7734[269482] (235 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7735[269482] (539 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7736[269482] (95 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7737[269482] (543 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7738[269482] (160 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7739[269482] (209 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7740[269482] (291 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7741[269482] (84 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7742[269482] (171 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7743[269482] (163 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7744[269482] (141 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7745[269482] (954 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7746[269482] (281 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7747[269482] (539 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7748[269482] (48 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7749[269482] (108 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7750[269482] (92 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7751[269482] (102 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7752[269482] (131 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7753[269482] (2273 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7754[269482] (774 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7755[269482] (890 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7756[269482] (157 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7757[269482] (111 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7758[269482] (176 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7759[269482] (187 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7760[269482] (109 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7761[269482] (106 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7762[269482] (119 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7763[269482] (96 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7764[269482] (116 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7765[269482] (170 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7766[269482] (346 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7767[269482] (105 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7768[269482] (111 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7769[269482] (110 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7770[269482] (146 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7771[269482] (1354 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7772[269482] (164 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7773[269482] (243 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7774[269482] (283 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7775[269482] (467 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7030[269482] (414 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ENSP00000360938 pep:known-ccds chromosome:NCBI36:9:135518503:135... 88 2e-17 ENSP00000369667 pep:known-ccds chromosome:NCBI36:5:78329256:7840... 74 3e-13 ENSP00000255189 pep:known-ccds chromosome:NCBI36:5:78329186:7840... 74 3e-13 ENSP00000288050 pep:known chromosome:NCBI36:16:68705030:68752685... 69 1e-11 ENSP00000298628 pep:known chromosome:NCBI36:9:135580336:13559486... 67 3e-11 ENSP00000360933 pep:known chromosome:NCBI36:9:135573265:13558898... 55 1e-07 >ENSP00000360938 pep:known-ccds chromosome:NCBI36:9:135518503:135594863:-1 gene:ENSG00000123453 transcript:ENST00000371872 CCDS6978.1 Length = 918 Score = 88.2 bits (217), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 91/392 (23%), Positives = 164/392 (41%), Gaps = 25/392 (6%) Query: 34 DVVIVGGGGHGLATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNYLWDESAALY 93 +VV++GGG G T Y+LAK G+ ++E+ + G T ++ D L Sbjct: 68 NVVVIGGGSLGCQTLYHLAKL-GMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELL 126 Query: 94 EKAMKL-WEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPEQ 152 ++ L ++ + + Q G + +A Q + + +R ++ + GV++ L+P + Sbjct: 127 AHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAE 186 Query: 153 IKEIVPVINLNSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVIGIR-- 210 K + P++N++ Y G + G AR A G +I+NC V GIR Sbjct: 187 TKTLYPLMNVDDLY---GTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVW 243 Query: 211 -REGGA--VTGVDTVKGFIXXXXXXXXXXGNTTTLADMAGVRLPLESHPLQALVSEPIKP 267 + G V GV+T G I + + MAGV++PL + +V+E I+ Sbjct: 244 TDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEG 303 Query: 268 IINTVIMSNAVHAYISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMF----- 322 I N + + A + +GD + G + F + S G E+F Sbjct: 304 IQNMPNVRDH-DASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIE 362 Query: 323 ------PVFSRVRMNRQWGGIVDVSPDACPIISKT-DVKGLYFNCGWGTGGFKATPGSGW 375 PV + + G +PD P++ + +++G + CG+ + G G G Sbjct: 363 GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQ 422 Query: 376 VFAHTIANDAPHPLNAPFSLDRFYTGHLIDEH 407 AH I + P + + RF+ H + +H Sbjct: 423 ELAHWIIHGRPEKDMHGYDIRRFH--HSLTDH 452 >ENSP00000369667 pep:known-ccds chromosome:NCBI36:5:78329256:78401205:-1 gene:ENSG00000132837 transcript:ENST00000380311 CCDS4044.1 Length = 866 Score = 73.9 bits (180), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 76/358 (21%), Positives = 147/358 (41%), Gaps = 26/358 (7%) Query: 30 KKEYDVVIVGGGGHGLATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNYLWDES 89 K + VI+GGG G++ AY+LAK G++++ ++EK + G+T + + Sbjct: 47 KDRAETVIIGGGCVGVSLAYHLAKA-GMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINL 105 Query: 90 AALYEKAMKLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLT 149 ++ ++KL+E L ++ V F Q G + LA T V + + ++ + + + Sbjct: 106 KKIHYDSIKLYEKLEEETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYLIE 165 Query: 150 PEQIKEIVPVINLNSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVIGI 209 PE+I+E+ P++N+N VL + G ++ A GA + G + V + Sbjct: 166 PEKIQEMFPLLNMNK---VLAGLYNPGDGHIDPYSLTMALAAGARKCGALLKYPAPVTSL 222 Query: 210 RREGGAVTGVDTVKGFIXXXXXXXXXXGNTTTLADMAGVRLPLESHPLQALVSEPIKPII 269 + V+T +G + + M G+ PL Q +V+ I + Sbjct: 223 KARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK 282 Query: 270 ----NTVIMSNAVHAYISQSDKGDLVIGAGVDQYT--------------GFGQ---RGSF 308 ++ + +Y + ++ L+ G Q GFG+ Sbjct: 283 ALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDL 342 Query: 309 HIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDVSPDACPIISKTD-VKGLYFNCGWGTG 365 I ++A +EM PV + + G + SPD P++ V+ + G+G G Sbjct: 343 DRIMEHIKAAMEMVPVLKKADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYG 400 >ENSP00000255189 pep:known-ccds chromosome:NCBI36:5:78329186:78401205:-1 gene:ENSG00000132837 transcript:ENST00000255189 CCDS4044.1 Length = 866 Score = 73.9 bits (180), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 76/358 (21%), Positives = 147/358 (41%), Gaps = 26/358 (7%) Query: 30 KKEYDVVIVGGGGHGLATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNYLWDES 89 K + VI+GGG G++ AY+LAK G++++ ++EK + G+T + + Sbjct: 47 KDRAETVIIGGGCVGVSLAYHLAKA-GMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINL 105 Query: 90 AALYEKAMKLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLT 149 ++ ++KL+E L ++ V F Q G + LA T V + + ++ + + + Sbjct: 106 KKIHYDSIKLYEKLEEETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYLIE 165 Query: 150 PEQIKEIVPVINLNSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVIGI 209 PE+I+E+ P++N+N VL + G ++ A GA + G + V + Sbjct: 166 PEKIQEMFPLLNMNK---VLAGLYNPGDGHIDPYSLTMALAAGARKCGALLKYPAPVTSL 222 Query: 210 RREGGAVTGVDTVKGFIXXXXXXXXXXGNTTTLADMAGVRLPLESHPLQALVSEPIKPII 269 + V+T +G + + M G+ PL Q +V+ I + Sbjct: 223 KARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK 282 Query: 270 ----NTVIMSNAVHAYISQSDKGDLVIGAGVDQYT--------------GFGQ---RGSF 308 ++ + +Y + ++ L+ G Q GFG+ Sbjct: 283 ALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDL 342 Query: 309 HIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDVSPDACPIISKTD-VKGLYFNCGWGTG 365 I ++A +EM PV + + G + SPD P++ V+ + G+G G Sbjct: 343 DRIMEHIKAAMEMVPVLKKADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYG 400 >ENSP00000288050 pep:known chromosome:NCBI36:16:68705030:68752685:1 gene:ENSG00000090857 transcript:ENST00000288050 Length = 879 Score = 68.6 bits (166), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 91/392 (23%), Positives = 163/392 (41%), Gaps = 24/392 (6%) Query: 25 RSPEPKKEYDVVIVGGGGHGLATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNY 84 RS + VVI GGG G + AY+L+K G ++I ++E+G + G+T I+ + Sbjct: 35 RSMALPTQAQVVICGGGITGTSVAYHLSK-MGWKDIVLLEQGRLAAGSTRFCAGILSTAR 93 Query: 85 LWDESAALYEKAMKLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLN--G 142 + + + KL+ L Q+ +++ G + LA T QD + +R+NA LN G Sbjct: 94 HLTIEQKMADYSNKLYYQLEQETGIQTGYTRTGSIFLAQT-QDRLISLKRINAG-LNVIG 151 Query: 143 VDAEFLTPEQIKEIVPVINLNSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQ 202 + +E ++P+++ E+ ++N++ ++GA V VA A A Q GV I Sbjct: 152 IPSEIISPKKVAELHHLLNVHD---LVGAMHVPEDAVVSSADVALALASAASQNGVQIYD 208 Query: 203 NCQVIGIRREGGAVTGVDTVKGFIXXXXXXXXXX--GNTTTLADMAGVRLPLESHPLQAL 260 V+ + + G VTGV+T KG I L++ V +PL + L Sbjct: 209 RTSVLHVMVKKGQVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPVSIPLHACEHFYL 268 Query: 261 VSEPIKPIINT---VIMSNAVHAYISQSDKGDL----------VIGAGVDQYTGFGQRGS 307 ++ P++ + + I+ YI G L + G +Q + Sbjct: 269 LTRPLETPLQSSTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQED 328 Query: 308 FHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDVSPDA-CPIISKTDVKGLYFNCGWGTGG 366 + E L +++ P + + + +PD C + V+G + G + G Sbjct: 329 WDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAG 388 Query: 367 FKATPGSGWVFAHTIANDAPHPLNAPFSLDRF 398 G+G A + + P L RF Sbjct: 389 LSFGGGAGKYLAEWMVHGYPSENVWELDLKRF 420 >ENSP00000298628 pep:known chromosome:NCBI36:9:135580336:135594863:-1 gene:ENSG00000123453 transcript:ENST00000298628 Length = 396 Score = 67.4 bits (163), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 63/252 (25%), Positives = 111/252 (44%), Gaps = 20/252 (7%) Query: 34 DVVIVGGGGHGLATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNYLWD------ 87 +VV++GGG G T Y+LAK G+ ++E+ + G T + LW Sbjct: 68 NVVVIGGGSLGCQTLYHLAKL-GMSGAVLLERERLTSGTTWHT-----AGLLWQLRPSDV 121 Query: 88 ESAALYEKAMKLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEF 147 E L + L ++ + + Q G + +A Q + + +R ++ + GV++ Sbjct: 122 EVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHV 181 Query: 148 LTPEQIKEIVPVINLNSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVI 207 L+P + K + P++N++ Y G + G AR A G +I+NC V Sbjct: 182 LSPAETKTLYPLMNVDDLY---GTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVT 238 Query: 208 GIR---REGGA--VTGVDTVKGFIXXXXXXXXXXGNTTTLADMAGVRLPLESHPLQALVS 262 GIR + G V GV+T G I + + MAGV++PL + +V+ Sbjct: 239 GIRVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVT 298 Query: 263 EPIKPIINTVIM 274 E I+ I + ++ Sbjct: 299 ERIEGIQSFTLL 310 >ENSP00000360933 pep:known chromosome:NCBI36:9:135573265:135588986:-1 gene:ENSG00000123453 transcript:ENST00000371867 Length = 283 Score = 55.5 bits (132), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 45/173 (26%), Positives = 79/173 (45%), Gaps = 8/173 (4%) Query: 103 LSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPEQIKEIVPVINL 162 L ++ + + Q G + +A Q + + +R ++ + GV++ L+P + K + P++N+ Sbjct: 48 LEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNV 107 Query: 163 NSRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVIGIR---REGGA--VT 217 + Y G + G AR A G +I+NC V GIR + G V Sbjct: 108 DDLY---GTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVA 164 Query: 218 GVDTVKGFIXXXXXXXXXXGNTTTLADMAGVRLPLESHPLQALVSEPIKPIIN 270 GV+T G I + + MAGV++PL + +V+E I+ I N Sbjct: 165 GVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQN 217 BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7031[269482] (458 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7032[269482] (419 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ENSP00000333667 pep:known-ccds chromosome:NCBI36:12:55909819:559... 351 7e-97 ENSP00000318868 pep:known-ccds chromosome:NCBI36:17:18171920:182... 327 1e-89 ENSP00000318805 pep:known-ccds chromosome:NCBI36:17:18171920:182... 300 2e-81 ENSP00000345881 pep:known chromosome:NCBI36:17:18171920:18207581... 217 2e-56 >ENSP00000333667 pep:known-ccds chromosome:NCBI36:12:55909819:55914981:1 gene:ENSG00000182199 transcript:ENST00000328923 CCDS8934.1 Length = 504 Score = 351 bits (901), Expect = 7e-97, Method: Compositional matrix adjust. Identities = 189/399 (47%), Positives = 247/399 (61%), Gaps = 23/399 (5%) Query: 2 FSKEQTIAGFDPDLHEAMRLERQRQEAHIELIASENYTSPRVLEAQGSVLTNKYAEGYPG 61 ++ +++++ DP++ E ++ E+ RQ +ELIASEN+ S LEA GS L NKY+EGYPG Sbjct: 43 WTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPG 102 Query: 62 KRYYGGCEHVDVVEQLAISRAKALFNADFA----NVQPHSGSQANAAVYLALLTPGDTIL 117 KRYYGG E VD +E L RA F+ D A NVQP+SGS AN AVY ALL P D I+ Sbjct: 103 KRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIM 162 Query: 118 GMSLAHGGHLTHG-----AKVSFSGKVFNAVQYGVDATTGLIDYDEIERLALEHRPKMIV 172 G+ L GGHLTHG ++S + F ++ Y ++ TGLIDY+++ A RP++I+ Sbjct: 163 GLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLII 222 Query: 173 AGFSAYSRVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTL 232 AG SAY+R++D+AR R + D+V A+L DMAH++GLVAA + P+P AD+VTTTTHKTL Sbjct: 223 AGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTL 282 Query: 233 RGPRGGLILAR---------ANEEI----EKKLNSMVFPGTQGGPLMHXXXXXXXXFKEA 279 RG R GLI R EI E ++N VFP QGGP H K+A Sbjct: 283 RGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQA 342 Query: 280 LGPEFVTYQKQTLANARAMVEVFNARGYDVVSGGTDDHLFLVSLVKKGITGKDADAALGR 339 P F Y Q L NARAM + RGY +VSGGTD+HL LV L KG+ G A+ L Sbjct: 343 CTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLEL 402 Query: 340 AHITVNKNTVPNDPQSPFVTSGIRIGTPAITTRGFLEAD 378 IT NKNT P D +S G+R+G PA+T+R F E D Sbjct: 403 VSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDD 440 >ENSP00000318868 pep:known-ccds chromosome:NCBI36:17:18171920:18207581:-1 gene:ENSG00000176974 transcript:ENST00000316694 CCDS11196.1 Length = 483 Score = 327 bits (839), Expect = 1e-89, Method: Compositional matrix adjust. Identities = 193/430 (44%), Positives = 250/430 (58%), Gaps = 23/430 (5%) Query: 6 QTIAGFDPDLHEAMRLERQRQEAHIELIASENYTSPRVLEAQGSVLTNKYAEGYPGKRYY 65 Q + D +++ ++ E RQ +ELIASEN+ S VLEA GS L NKY+EGYPG+RYY Sbjct: 24 QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYY 83 Query: 66 GGCEHVDVVEQLAISRAKALFNAD----FANVQPHSGSQANAAVYLALLTPGDTILGMSL 121 GG E +D +E L RA + D NVQP+SGS AN AVY AL+ P I+G+ L Sbjct: 84 GGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDL 143 Query: 122 AHGGHLTHG-----AKVSFSGKVFNAVQYGVDATTGLIDYDEIERLALEHRPKMIVAGFS 176 GGHLTHG K+S + F ++ Y V+ TG I+YD++E A PK+I+AG S Sbjct: 144 PDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTS 203 Query: 177 AYSRVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLRGPR 236 YSR L++AR R IAD+ GAYL DMAH++GLVAAG+ P+P VVTTTTHKTLRG R Sbjct: 204 CYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCR 263 Query: 237 GGLILAR---------ANEEI----EKKLNSMVFPGTQGGPLMHXXXXXXXXFKEALGPE 283 G+I R +EI E +NS VFPG QGGP H K+A+ E Sbjct: 264 AGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLE 323 Query: 284 FVTYQKQTLANARAMVEVFNARGYDVVSGGTDDHLFLVSLVKKGITGKDADAALGRAHIT 343 F YQ Q +AN RA+ E GY +V+GG+D+HL LV L KG G A+ L I Sbjct: 324 FKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIA 383 Query: 344 VNKNTVPNDPQSPFVTSGIRIGTPAITTRGFLEADAAHTAQLMCDALDRLGDAQVEAAVR 403 NKNT P D +S SG+R+GTPA+T+RG LE D A + ++ Q + VR Sbjct: 384 CNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVR 442 Query: 404 TQVAQLCARF 413 + + R Sbjct: 443 ATLKEFKERL 452 >ENSP00000318805 pep:known-ccds chromosome:NCBI36:17:18171920:18207581:-1 gene:ENSG00000176974 transcript:ENST00000354098 CCDS11197.1 Length = 444 Score = 300 bits (768), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 179/417 (42%), Positives = 235/417 (56%), Gaps = 36/417 (8%) Query: 6 QTIAGFDPDLHEAMRLERQRQEAHIELIASENYTSPRVLEAQGSVLTNKYAEGYPGKRYY 65 Q + D +++ ++ E RQ +ELIASEN+ S VLEA GS L NKY+EGYPG+RYY Sbjct: 24 QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYY 83 Query: 66 GGCEHVDVVEQLAISRAKALFNAD----FANVQPHSGSQANAAVYLALLTPGDTILGMSL 121 GG E +D +E L RA + D NVQP+SGS AN AVY AL+ P I+G+ L Sbjct: 84 GGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDL 143 Query: 122 AHGGHLTHG-----AKVSFSGKVFNAVQYGVDATTGLIDYDEIERLALEHRPKMIVAGFS 176 GGHLTHG K+S + F ++ Y V+ TG I+YD++E A PK+I+AG S Sbjct: 144 PDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTS 203 Query: 177 AYSRVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLRGPR 236 YSR L++AR R IAD+ GAYL DMAH++GLVAAG+ P+P VVTTTTHKTLRG R Sbjct: 204 CYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCR 263 Query: 237 GGLILARANEEIEKKLNSMVFPGTQGGPLMHXXXXXXXXFKEALGPEFVTYQKQTLANAR 296 G+I R + K+A+ EF YQ Q +AN R Sbjct: 264 AGMIFYRKGVAV--------------------------ALKQAMTLEFKVYQHQVVANCR 297 Query: 297 AMVEVFNARGYDVVSGGTDDHLFLVSLVKKGITGKDADAALGRAHITVNKNTVPNDPQSP 356 A+ E GY +V+GG+D+HL LV L KG G A+ L I NKNT P D +S Sbjct: 298 ALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSA 356 Query: 357 FVTSGIRIGTPAITTRGFLEADAAHTAQLMCDALDRLGDAQVEAAVRTQVAQLCARF 413 SG+R+GTPA+T+RG LE D A + ++ Q + VR + + R Sbjct: 357 LRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERL 413 >ENSP00000345881 pep:known chromosome:NCBI36:17:18171920:18207581:-1 gene:ENSG00000176974 transcript:ENST00000352886 Length = 403 Score = 217 bits (553), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 125/247 (50%), Positives = 160/247 (64%), Gaps = 9/247 (3%) Query: 6 QTIAGFDPDLHEAMRLERQRQEAHIELIASENYTSPRVLEAQGSVLTNKYAEGYPGKRYY 65 Q + D +++ ++ E RQ +ELIASEN+ S VLEA GS L NKY+EGYPG+RYY Sbjct: 24 QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYY 83 Query: 66 GGCEHVDVVEQLAISRAKALFNAD----FANVQPHSGSQANAAVYLALLTPGDTILGMSL 121 GG E +D +E L RA + D NVQP+SGS AN AVY AL+ P I+G+ L Sbjct: 84 GGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDL 143 Query: 122 AHGGHLTHG-----AKVSFSGKVFNAVQYGVDATTGLIDYDEIERLALEHRPKMIVAGFS 176 GGHLTHG K+S + F ++ Y V+ TG I+YD++E A PK+I+AG S Sbjct: 144 PDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTS 203 Query: 177 AYSRVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLRGPR 236 YSR L++AR R IAD+ GAYL DMAH++GLVAAG+ P+P VVTTTTHKTLRG R Sbjct: 204 CYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCR 263 Query: 237 GGLILAR 243 G+I R Sbjct: 264 AGMIFYR 270 Score = 72.0 bits (175), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 1/102 (0%) Query: 312 GGTDDHLFLVSLVKKGITGKDADAALGRAHITVNKNTVPNDPQSPFVTSGIRIGTPAITT 371 GG+D+HL LV L KG G A+ L I NKNT P D +S SG+R+GTPA+T+ Sbjct: 272 GGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTS 330 Query: 372 RGFLEADAAHTAQLMCDALDRLGDAQVEAAVRTQVAQLCARF 413 RG LE D A + ++ Q + VR + + R Sbjct: 331 RGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERL 372 BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7033[269482] (403 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7034[269482] (338 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7035[269482] (87 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7036[269482] (253 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7038[269482] (99 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7039[269482] (131 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7040[269482] (147 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7043[269482] (278 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7044[269482] (132 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7045[269482] (320 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7046[269482] (460 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7047[269482] (330 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7048[269482] (660 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7049[269482] (213 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7050[269482] (701 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7051[269482] (84 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7052[269482] (227 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Bcep1808_7053[269482] (356 letters) Database: Homo_sapiens.NCBI36.45.pep.all.fa 43,570 sequences; 22,086,541 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search pr